(data stored in ACNUC7421 zone)

EMBL: CP001622.PE294

CP001622.PE294       Location/Qualifiers
FT   CDS             304570..305724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0295"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG: thuBf;
FT                   myo-inositol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54606"
FT                   /db_xref="GOA:C6B0I7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I7"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACS54606.1"
FT                   /translation="MTKIFRFGVIGCGLMGREFASAAARWLHLADVKARPEIVAVCDTN
FT                   ATLLDWFRDHVPTVRQFAADYKELLANPEVDAVYCAVPHVLHQQFYIDVLKAGKHLLGE
FT                   KPFGMDAAQNRDIMAVLAEHPELLVRCSSEMPFFPGAQKVIALAKSGEMGDIIEVEAGF
FT                   LHSSDIDRQKPINWKRMADINGDYGCMGDLGMHVLHVPLRLGWRPTTLHAQLVKKVTER
FT                   PDGKGGMLPCTTWDNATISSRVRTGDQDFPMVLKTWRIAPGESNTWYLRVLGMKKSAFF
FT                   STKSPRQWQWMDYNGGVQAWSTEDLGYGSLFPAITGKIFEFGFADAIQQMWAAFVDELV
FT                   GGNANGFGCATPAEAQAHHAVLTAALKSGLEDVVIPVEYDGASA"
     MTKIFRFGVI GCGLMGREFA SAAARWLHLA DVKARPEIVA VCDTNATLLD WFRDHVPTVR        60
     QFAADYKELL ANPEVDAVYC AVPHVLHQQF YIDVLKAGKH LLGEKPFGMD AAQNRDIMAV       120
     LAEHPELLVR CSSEMPFFPG AQKVIALAKS GEMGDIIEVE AGFLHSSDID RQKPINWKRM       180
     ADINGDYGCM GDLGMHVLHV PLRLGWRPTT LHAQLVKKVT ERPDGKGGML PCTTWDNATI       240
     SSRVRTGDQD FPMVLKTWRI APGESNTWYL RVLGMKKSAF FSTKSPRQWQ WMDYNGGVQA       300
     WSTEDLGYGS LFPAITGKIF EFGFADAIQQ MWAAFVDELV GGNANGFGCA TPAEAQAHHA       360
     VLTAALKSGL EDVVIPVEYD GASA                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page