(data stored in ACNUC7421 zone)

EMBL: CP001622.PE295

CP001622.PE295       Location/Qualifiers
FT   CDS             305724..306395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0296"
FT                   /product="protein of unknown function DUF1498"
FT                   /note="PFAM: protein of unknown function DUF1498; KEGG:
FT                   hypothetical protein; K09988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54607"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I8"
FT                   /inference="protein motif:PFAM:PF07385"
FT                   /protein_id="ACS54607.1"
FT                   /translation="MKRSEINAALLRATETLERWHWSLPAWGSWTAADFAAHPEASAYL
FT                   RAHQLGWDVTDFGSNRFAECGLVLFSLRNGVVDIRGERTYAEKLLFVGEGQVTPTHRHA
FT                   AKMEDIINRAGGDLVIEFAATDADGNVLAEDVTVPVDGLQHRLAAWEPLVLQPGQSVTI
FT                   RTGLYHRFYGRKGGGPVLVGEVSQVNDDNSDNFFLEPIARFAAIEEDEPPLRPLWNEGV
FT                   S"
     MKRSEINAAL LRATETLERW HWSLPAWGSW TAADFAAHPE ASAYLRAHQL GWDVTDFGSN        60
     RFAECGLVLF SLRNGVVDIR GERTYAEKLL FVGEGQVTPT HRHAAKMEDI INRAGGDLVI       120
     EFAATDADGN VLAEDVTVPV DGLQHRLAAW EPLVLQPGQS VTIRTGLYHR FYGRKGGGPV       180
     LVGEVSQVND DNSDNFFLEP IARFAAIEED EPPLRPLWNE GVS                         223
//

If you have problems or comments...

PBIL Back to PBIL home page