(data stored in ACNUC7421 zone)

EMBL: CP001622.PE296

CP001622.PE296       Location/Qualifiers
FT   CDS             306395..307453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0297"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: iolC; myo-inositol
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54608"
FT                   /db_xref="GOA:C6B0I9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I9"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54608.1"
FT                   /translation="MRAGEEVHDRDSQKQGGIVCAGNFIVDRVHTLSYWPEQGNLAHIL
FT                   HQDLGVGGGAANVVTDLASLGFPGKLAAAGCIGADQDGEIVKARLAVAGVDVVGLTALA
FT                   DRVTAHTHVMNVPGQNRTFFYHGGANDAVTDELVSPAAFAKAGYRLFYLGYLMLLPGLD
FT                   RIGPDGRSGASRLLEAARRAGLTTCVDFVSSEDPEFAAKVGVALPFCDYLIINEMEAGR
FT                   ATGVIVRDAEGDLTEAGLLEAGERLLAAGVSKGAIIHAPETCFWFSPGASPIMTRSRPV
FT                   DPDDIVSTVGAGDAFCAAVLYGLHENWPVEHICAVAHAAAARCLKGATATDGIPDMSVL
FT                   IREAKETNPQSA"
     MRAGEEVHDR DSQKQGGIVC AGNFIVDRVH TLSYWPEQGN LAHILHQDLG VGGGAANVVT        60
     DLASLGFPGK LAAAGCIGAD QDGEIVKARL AVAGVDVVGL TALADRVTAH THVMNVPGQN       120
     RTFFYHGGAN DAVTDELVSP AAFAKAGYRL FYLGYLMLLP GLDRIGPDGR SGASRLLEAA       180
     RRAGLTTCVD FVSSEDPEFA AKVGVALPFC DYLIINEMEA GRATGVIVRD AEGDLTEAGL       240
     LEAGERLLAA GVSKGAIIHA PETCFWFSPG ASPIMTRSRP VDPDDIVSTV GAGDAFCAAV       300
     LYGLHENWPV EHICAVAHAA AARCLKGATA TDGIPDMSVL IREAKETNPQ SA               352
//

If you have problems or comments...

PBIL Back to PBIL home page