(data stored in ACNUC7421 zone)

EMBL: CP001622.PE297

CP001622.PE297       Location/Qualifiers
FT   CDS             307589..308377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0298"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   smoS; sorbitol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54609"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54609.1"
FT                   /translation="MTHTETARLSGKVALVTGGASGIGKAVCQRFAAEGARVVVADLDG
FT                   ERCARVAEAIGPDVWGAALDVTRQDSIEEAVRFTISTAGQIDILVNAAGIYDVESILEI
FT                   SRERTARVFQVNIEGLIFMTQAVARHMVERGEGGRIINFSSQAGRRGEGPAVAYCASKA
FT                   AVISITQSCALELIRYGINVNAIAPGVVDTPMWDVVDAKLGSREGLRPGDVKRRVAAAV
FT                   PAGRFGAPQEQAAMAAFLAGPDAAYIVAQCYNVDGGNVMS"
     MTHTETARLS GKVALVTGGA SGIGKAVCQR FAAEGARVVV ADLDGERCAR VAEAIGPDVW        60
     GAALDVTRQD SIEEAVRFTI STAGQIDILV NAAGIYDVES ILEISRERTA RVFQVNIEGL       120
     IFMTQAVARH MVERGEGGRI INFSSQAGRR GEGPAVAYCA SKAAVISITQ SCALELIRYG       180
     INVNAIAPGV VDTPMWDVVD AKLGSREGLR PGDVKRRVAA AVPAGRFGAP QEQAAMAAFL       240
     AGPDAAYIVA QCYNVDGGNV MS                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page