(data stored in ACNUC7421 zone)

EMBL: CP001622.PE298

CP001622.PE298       Location/Qualifiers
FT   CDS             308435..309445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0299"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   L-iditol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54610"
FT                   /db_xref="GOA:C6B0J1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J1"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACS54610.1"
FT                   /translation="MRAVRLESIGSLTMRSVERPVAGPGELLVRVAVAGICGSDRHMYK
FT                   GEYPTAIPVTLGHELCGIVEAIGDTVTRFTGGELVTVDPNIACGTCRACTQARPNLCES
FT                   LTAIGVTRDGGFAEYVAVPQAQAFVLPAGLDPVHGAFSEPLACCIHAIDKARIRPGDSV
FT                   AILGGGVIGLLMVQLARLAGAGEIILITRQQSRRQTALRLGATHAFDPTSSDTIASVRE
FT                   VTKGGADVVIECAGVSDTLQSGLKMARRGGTFVLFGVTPAGVEVPVLPFDLLVNEVDIR
FT                   PAYLNPFTHSRAAAMVASGVLELDALVTKTISLEEVADVVGNAPLPGEIKVIVRP"
     MRAVRLESIG SLTMRSVERP VAGPGELLVR VAVAGICGSD RHMYKGEYPT AIPVTLGHEL        60
     CGIVEAIGDT VTRFTGGELV TVDPNIACGT CRACTQARPN LCESLTAIGV TRDGGFAEYV       120
     AVPQAQAFVL PAGLDPVHGA FSEPLACCIH AIDKARIRPG DSVAILGGGV IGLLMVQLAR       180
     LAGAGEIILI TRQQSRRQTA LRLGATHAFD PTSSDTIASV REVTKGGADV VIECAGVSDT       240
     LQSGLKMARR GGTFVLFGVT PAGVEVPVLP FDLLVNEVDI RPAYLNPFTH SRAAAMVASG       300
     VLELDALVTK TISLEEVADV VGNAPLPGEI KVIVRP                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page