(data stored in ACNUC7421 zone)

EMBL: CP001622.PE299

CP001622.PE299       Location/Qualifiers
FT   CDS             complement(309461..310480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0300"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: transcriptional regulator
FT                   protein; K02529 LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54611"
FT                   /db_xref="GOA:C6B0J2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS54611.1"
FT                   /translation="MTTSIRHIAKLAGTSVSSVSRVLNNSGYASPELRERVEAAIRTLN
FT                   YTPSKGARMLRGAPSRMIGLMLPSVDVPFFGILAHAIEQELFQHGYQTLICSTAENMDH
FT                   EVRYISMLLAQRVDGVIVASAFGSIEHFGVLRDAGIPIIAIDRELSGIADDAVMADHEE
FT                   GGRLMARHLIDLGHRAIAIVGAPAHSQPIQLRLQGITAEMAKDGIAPAIVAMAEEHSFA
FT                   ETYRLARELLASRPEVTAIIGTTDVSAIAAIHAIQDRGFSVPGDYSVVGFDDLPEAAYV
FT                   FPRLTTVAQPIRNVGQQAARLLEALIEEHQTGDESRQGAIVKVPVTLIERDSTGLVRN"
     MTTSIRHIAK LAGTSVSSVS RVLNNSGYAS PELRERVEAA IRTLNYTPSK GARMLRGAPS        60
     RMIGLMLPSV DVPFFGILAH AIEQELFQHG YQTLICSTAE NMDHEVRYIS MLLAQRVDGV       120
     IVASAFGSIE HFGVLRDAGI PIIAIDRELS GIADDAVMAD HEEGGRLMAR HLIDLGHRAI       180
     AIVGAPAHSQ PIQLRLQGIT AEMAKDGIAP AIVAMAEEHS FAETYRLARE LLASRPEVTA       240
     IIGTTDVSAI AAIHAIQDRG FSVPGDYSVV GFDDLPEAAY VFPRLTTVAQ PIRNVGQQAA       300
     RLLEALIEEH QTGDESRQGA IVKVPVTLIE RDSTGLVRN                              339
//

If you have problems or comments...

PBIL Back to PBIL home page