(data stored in ACNUC7421 zone)

EMBL: CP001622.PE3

CP001622.PE3         Location/Qualifiers
FT   CDS             complement(2893..4095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0003"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000399 oxygen-independent
FT                   coprophorphyrinogen III oxidase protein; TIGRFAM:
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM domain protein; HemN domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54315"
FT                   /db_xref="GOA:C6AY91"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY91"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ACS54315.1"
FT                   /translation="MDNFDTPSTSRDAALLPDTGEPGFGVYVHWPFCAAKCPYCDFNSH
FT                   VRHQPVDQERFTSAFLTEMAAVRAMSGPKTVTSIFLGGGTPSLMKPEAVSAILDGIARH
FT                   WHVPDGIEITMEANPSSVEAERFRGYRAAGVNRVSLGVQALNDRDLKFLGRLHDVADAL
FT                   KAIRLARDIFPRMSFDLIYARPDQTVEEWEKELKEAISYAVDHLSLYQLTIEEGTPFYG
FT                   LHKAGKLIVPDGEQSAVLYEATQEITAREGMPAYEVSNHARPGAESRHNLTYWRYGDYA
FT                   GIGPGAHGRLTRGPEKLATATERKPETWLDMVERDGHGILDEERLGFEEQSDELLLMGL
FT                   RLREGVDLARWQQLSGRDLDPKREEFLLEHKFIERIGNSRLRCTPSGMLILDSVVADLA
FT                   C"
     MDNFDTPSTS RDAALLPDTG EPGFGVYVHW PFCAAKCPYC DFNSHVRHQP VDQERFTSAF        60
     LTEMAAVRAM SGPKTVTSIF LGGGTPSLMK PEAVSAILDG IARHWHVPDG IEITMEANPS       120
     SVEAERFRGY RAAGVNRVSL GVQALNDRDL KFLGRLHDVA DALKAIRLAR DIFPRMSFDL       180
     IYARPDQTVE EWEKELKEAI SYAVDHLSLY QLTIEEGTPF YGLHKAGKLI VPDGEQSAVL       240
     YEATQEITAR EGMPAYEVSN HARPGAESRH NLTYWRYGDY AGIGPGAHGR LTRGPEKLAT       300
     ATERKPETWL DMVERDGHGI LDEERLGFEE QSDELLLMGL RLREGVDLAR WQQLSGRDLD       360
     PKREEFLLEH KFIERIGNSR LRCTPSGMLI LDSVVADLAC                             400
//

If you have problems or comments...

PBIL Back to PBIL home page