(data stored in ACNUC7421 zone)

EMBL: CP001622.PE30

CP001622.PE30        Location/Qualifiers
FT   CDS             complement(28490..29911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0031"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: rec:RHECIAT_CH0000416 putative
FT                   2-methylthioadenine synthetase (MiaB-like) protein;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: Protein of unknown
FT                   function UPF0004; Radical SAM domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54342"
FT                   /db_xref="GOA:C6AYB8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB8"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ACS54342.1"
FT                   /translation="MTQDSALLQAPEAIPSDSLHDGSNSRKVFIKTYGCQMNVYDSMRM
FT                   SDALARDGYEPTDDMEEADLVLLNTCHIREKAAEKVYSALGRLRDMKKKKAADGREMMI
FT                   GVAGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRLAKQGQRVVDTEYAIEDKFEH
FT                   LPIAESRRIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEVSRPVSQIVEEAEKLADSG
FT                   VREITLLGQNVNAWHGAGPQGEAWSLGDLLYRLAEIPGLARLRYTTSHPRDMDDRLINA
FT                   HRDLSALMPYLHLPVQSGSDRILKAMNRRHTAAEYLTLIERIRTVRPDIALSGDFITGF
FT                   PGETDEDFKDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQVPEEIKAERLERLQMLL
FT                   LKQQQEFAESCIGKEIDLLLEKPGRMPEQLIGRSPWLQSVNVDAKASQIGDIIKVRITG
FT                   TGTNSLFAERAEAAV"
     MTQDSALLQA PEAIPSDSLH DGSNSRKVFI KTYGCQMNVY DSMRMSDALA RDGYEPTDDM        60
     EEADLVLLNT CHIREKAAEK VYSALGRLRD MKKKKAADGR EMMIGVAGCV AQAEGEEILR       120
     RAPAVDVVIG PQTYHRLPEA LRLAKQGQRV VDTEYAIEDK FEHLPIAESR RIRARGVTAF       180
     LTVQEGCDKF CTFCVVPYTR GSEVSRPVSQ IVEEAEKLAD SGVREITLLG QNVNAWHGAG       240
     PQGEAWSLGD LLYRLAEIPG LARLRYTTSH PRDMDDRLIN AHRDLSALMP YLHLPVQSGS       300
     DRILKAMNRR HTAAEYLTLI ERIRTVRPDI ALSGDFITGF PGETDEDFKD TLRLVEEVRY       360
     AQAFSFKYST RPGTPGAELK DQVPEEIKAE RLERLQMLLL KQQQEFAESC IGKEIDLLLE       420
     KPGRMPEQLI GRSPWLQSVN VDAKASQIGD IIKVRITGTG TNSLFAERAE AAV              473
//

If you have problems or comments...

PBIL Back to PBIL home page