(data stored in ACNUC7421 zone)

EMBL: CP001622.PE300

CP001622.PE300       Location/Qualifiers
FT   CDS             310730..311380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ots:OTBS_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54612"
FT                   /db_xref="GOA:C6B0J3"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J3"
FT                   /inference="similar to AA sequence:KEGG:OTBS_0057"
FT                   /protein_id="ACS54612.1"
FT                   /translation="MNDTVLLFHGIARTKKSMAKLAGFLSGHGYRVVNVGYPSTRFSIS
FT                   DLIDIIRPEIDDAVKKAGDGRVHFVGYSMGGLVIRAFLRRYRPAKLGRVVMVGTPNNGS
FT                   QIADFLKSWPLYRKIYGPAGQQLITDQTAMTELFGTVDYELGIIAGNRTIDPVSSLIIG
FT                   LRVPNDGKVSVESTRLGGAAAHIVIPANHTFLPVNKTMWSQALSFLKDGRFTS"
     MNDTVLLFHG IARTKKSMAK LAGFLSGHGY RVVNVGYPST RFSISDLIDI IRPEIDDAVK        60
     KAGDGRVHFV GYSMGGLVIR AFLRRYRPAK LGRVVMVGTP NNGSQIADFL KSWPLYRKIY       120
     GPAGQQLITD QTAMTELFGT VDYELGIIAG NRTIDPVSSL IIGLRVPNDG KVSVESTRLG       180
     GAAAHIVIPA NHTFLPVNKT MWSQALSFLK DGRFTS                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page