(data stored in ACNUC7421 zone)

EMBL: CP001622.PE301

CP001622.PE301       Location/Qualifiers
FT   CDS             311455..312600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0302"
FT                   /product="polysaccharidase protein"
FT                   /note="KEGG: ret:RHE_CH00615 polysaccharidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54613"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00615"
FT                   /protein_id="ACS54613.1"
FT                   /translation="MTAILRKKVHGASTRGQVIDGAPDVGVAYQVFSDTVIEDVIVKNS
FT                   PRGFKFHNGKNLTVRRCETENVNGDGIYLTKTTHVLLENNRIGAAPGEGADCCQFAYQN
FT                   SDDNISSDIVIRGNLFLQSPASASNKGALVCDKTRQYLVEYNFIGGKNFSFSSIGDDAV
FT                   VRSNIMRDGRMNDYSFGYGVGDKADHAGHHIYDNWIENTNRGVSLSGFSDQELAFRKDI
FT                   DIHDNVISQCDIAFFANRRWSGSFRRNIFLRCEQDIVLKGNGKATAGDIDGNYRNDGSF
FT                   LNVTPPPLRLKPDGNASVASGEWTSEPDEIRIQWRNKGIDIPGANRPSFTAEPGMELSC
FT                   VLLARKDQNWMLAIAETAYDDFTPRAWQEHKLPWQKRYLSI"
     MTAILRKKVH GASTRGQVID GAPDVGVAYQ VFSDTVIEDV IVKNSPRGFK FHNGKNLTVR        60
     RCETENVNGD GIYLTKTTHV LLENNRIGAA PGEGADCCQF AYQNSDDNIS SDIVIRGNLF       120
     LQSPASASNK GALVCDKTRQ YLVEYNFIGG KNFSFSSIGD DAVVRSNIMR DGRMNDYSFG       180
     YGVGDKADHA GHHIYDNWIE NTNRGVSLSG FSDQELAFRK DIDIHDNVIS QCDIAFFANR       240
     RWSGSFRRNI FLRCEQDIVL KGNGKATAGD IDGNYRNDGS FLNVTPPPLR LKPDGNASVA       300
     SGEWTSEPDE IRIQWRNKGI DIPGANRPSF TAEPGMELSC VLLARKDQNW MLAIAETAYD       360
     DFTPRAWQEH KLPWQKRYLS I                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page