(data stored in ACNUC7421 zone)

EMBL: CP001622.PE302

CP001622.PE302       Location/Qualifiers
FT   CDS             complement(312632..313738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0303"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: cak:Caul_4545
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54614"
FT                   /db_xref="GOA:C6B0J5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J5"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACS54614.1"
FT                   /translation="MHQAKKMTSNNRRLVGLDGIRGLAAICVAVHHTEGFVGFDAAPAA
FT                   YLAVDLFFCLSGFVIGHAYERKLIQESSLSANDFAIKRLIRLYPLYLLGLLLGVLAYAG
FT                   MSLSRNQQIDPMLFATSLIASMFFLPAIGGTSLKAPNLFPFNGPSWSLFLEIVINLAYG
FT                   YAARMLSSGVLALILLASWVWLAAQTLAHGSADLIPLDGALLSGFPRVLFSFSLGILMY
FT                   RYRQRLSPSGIGKAAAVTTIVVATALLVFQAPAAWVGIKDLIVITALFPIAVLVLYTAN
FT                   FDGVLRQPLLIAGEASYALYAIHVPLLGLLLGAWKAAGLGQPPAWAIFAIVLPLIVLLA
FT                   IVVTRLYDEPVRKALSAGKAMRLRWRRS"
     MHQAKKMTSN NRRLVGLDGI RGLAAICVAV HHTEGFVGFD AAPAAYLAVD LFFCLSGFVI        60
     GHAYERKLIQ ESSLSANDFA IKRLIRLYPL YLLGLLLGVL AYAGMSLSRN QQIDPMLFAT       120
     SLIASMFFLP AIGGTSLKAP NLFPFNGPSW SLFLEIVINL AYGYAARMLS SGVLALILLA       180
     SWVWLAAQTL AHGSADLIPL DGALLSGFPR VLFSFSLGIL MYRYRQRLSP SGIGKAAAVT       240
     TIVVATALLV FQAPAAWVGI KDLIVITALF PIAVLVLYTA NFDGVLRQPL LIAGEASYAL       300
     YAIHVPLLGL LLGAWKAAGL GQPPAWAIFA IVLPLIVLLA IVVTRLYDEP VRKALSAGKA       360
     MRLRWRRS                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page