(data stored in ACNUC7421 zone)

EMBL: CP001622.PE303

CP001622.PE303       Location/Qualifiers
FT   CDS             complement(313725..315080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0304"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG:
FT                   rec:RHECIAT_CH0003464 putative exopolysaccharide production
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54615"
FT                   /db_xref="GOA:C6B0J6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J6"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACS54615.1"
FT                   /translation="MSTSFDSYQPIGLQRHRPRARAQYRIRRETLVRILLSAIFYISLW
FT                   RATGMWYGLPADFQEGVGKDPMPMRLLLMSLVPLIGLYCLLEPRRVVEMLRSASPLVGI
FT                   ICLCVFLSIAFSVSVTASLRALVAVALLTAGPLLYRARYGAVDTFESLAKFAIATAFIN
FT                   ILYTAAFPRFAVMRGSYAGMVKGAFYHKNMLGQFSATNFILLLPALPMWRLRYYDLLRW
FT                   AAMLLYLVLIVLAKSSTAIILLSIGIAVYYGMSWIQRFPGRIFRSFVVLLAFALLGFVV
FT                   SVALMGVAQAIAESFGKDLTLSGRTNVWEQLLPLIYERPFSGWGFALFRQPDIMEQYVR
FT                   LTWDAQSTHNTYIELALNMGIPATIIWTSFVVVRLVGKMTSSPLNQALAITKRKEVVII
FT                   LLILIGAFTEAGMMLAPFILWPHTVIALTSLGPEFLSRFRKPTQAGAQHASG"
     MSTSFDSYQP IGLQRHRPRA RAQYRIRRET LVRILLSAIF YISLWRATGM WYGLPADFQE        60
     GVGKDPMPMR LLLMSLVPLI GLYCLLEPRR VVEMLRSASP LVGIICLCVF LSIAFSVSVT       120
     ASLRALVAVA LLTAGPLLYR ARYGAVDTFE SLAKFAIATA FINILYTAAF PRFAVMRGSY       180
     AGMVKGAFYH KNMLGQFSAT NFILLLPALP MWRLRYYDLL RWAAMLLYLV LIVLAKSSTA       240
     IILLSIGIAV YYGMSWIQRF PGRIFRSFVV LLAFALLGFV VSVALMGVAQ AIAESFGKDL       300
     TLSGRTNVWE QLLPLIYERP FSGWGFALFR QPDIMEQYVR LTWDAQSTHN TYIELALNMG       360
     IPATIIWTSF VVVRLVGKMT SSPLNQALAI TKRKEVVIIL LILIGAFTEA GMMLAPFILW       420
     PHTVIALTSL GPEFLSRFRK PTQAGAQHAS G                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page