(data stored in ACNUC7421 zone)

EMBL: CP001622.PE304

CP001622.PE304       Location/Qualifiers
FT   CDS             complement(315124..315858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: si:ch211-139a5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54616"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54616.1"
FT                   /translation="MLRLFANLVIVLALNFLLIVGNAGPSFAQECPDPAKATNASAQQK
FT                   QASKRLNRALPSYRVKSARYNLALVGDSLVELWQPWIKDSFPTRPAMNLAVAGDTTQNA
FT                   LYRLDDLDLPDFHPTDVVVLIGTNNLGAKTAPCAVAAGVVAVVSKVRALWPGAHIYALS
FT                   IPPRGKRYAFYEDVRIPANQLVASSLAEMPGVTFVQMNDDMLRCGKPSDKDCSNYKPDH
FT                   LHFNEGAYKLITSFLAAAGLQL"
     MLRLFANLVI VLALNFLLIV GNAGPSFAQE CPDPAKATNA SAQQKQASKR LNRALPSYRV        60
     KSARYNLALV GDSLVELWQP WIKDSFPTRP AMNLAVAGDT TQNALYRLDD LDLPDFHPTD       120
     VVVLIGTNNL GAKTAPCAVA AGVVAVVSKV RALWPGAHIY ALSIPPRGKR YAFYEDVRIP       180
     ANQLVASSLA EMPGVTFVQM NDDMLRCGKP SDKDCSNYKP DHLHFNEGAY KLITSFLAAA       240
     GLQL                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page