(data stored in ACNUC7421 zone)

EMBL: CP001622.PE305

CP001622.PE305       Location/Qualifiers
FT   CDS             316093..316899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0306"
FT                   /product="Ku protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000691 putative DNA helicase
FT                   protein; TIGRFAM: Ku protein; PFAM: Ku domain protein;
FT                   SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54617"
FT                   /db_xref="GOA:C6B0J8"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J8"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACS54617.1"
FT                   /translation="MARQTFWKGYLKLSLVTAAVSLTPATTESNKVRFHVLNRQTKNRV
FT                   ESRYVDSVTHKPVAERDQVKGYPRGEDDYVLLEDEEIEEVGLESTRTIEIDNFVPRGSI
FT                   DWIWYDKPHFLAPEDKVGVEAFCVIREAMKANDVVGIARLVLYRRERAVLLEPLGKGIV
FT                   LWTLRYGDEVRDPVAELDNKTEIDSKLLALMTQLVKEETKNWSPAMVQDPIQKRLKSMI
FT                   RGKQKSLKKAAPAQKPAPVKSTGNVINIMDALKKSLAAEGGQKPRQ"
     MARQTFWKGY LKLSLVTAAV SLTPATTESN KVRFHVLNRQ TKNRVESRYV DSVTHKPVAE        60
     RDQVKGYPRG EDDYVLLEDE EIEEVGLEST RTIEIDNFVP RGSIDWIWYD KPHFLAPEDK       120
     VGVEAFCVIR EAMKANDVVG IARLVLYRRE RAVLLEPLGK GIVLWTLRYG DEVRDPVAEL       180
     DNKTEIDSKL LALMTQLVKE ETKNWSPAMV QDPIQKRLKS MIRGKQKSLK KAAPAQKPAP       240
     VKSTGNVINI MDALKKSLAA EGGQKPRQ                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page