(data stored in ACNUC7421 zone)

EMBL: CP001622.PE306

CP001622.PE306       Location/Qualifiers
FT   CDS             complement(317078..317932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0307"
FT                   /product="Ku protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000693 putative DNA helicase
FT                   protein; TIGRFAM: Ku protein; PFAM: Ku domain protein;
FT                   SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54618"
FT                   /db_xref="GOA:C6B0J9"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J9"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACS54618.1"
FT                   /translation="MAARASWKGHLKVGDLACAVGLYTAVSSSDRVSFNIINRRTGHRV
FT                   ERQFVDSETGKPVERGDQVKGYQMENGDYIVIEGDEIAEIMPESDKVLNIKAFIAYDDI
FT                   DKLYFDRPYYLAPVDEHDEEALSLIARGMRDGKVAALAEAVLFRRNRTLLIRPHDDYIV
FT                   ATMLNFDYEVRSAETVFEDIPDIKFDKEMIALAGHIIGTKQGSFEPSTYEDRYEAALVE
FT                   LVKAKIEGRAPPKKKPAPERKVVDLMEALRQSAKMSGNAPAKKALAKKKAPARSDSRSK
FT                   KAS"
     MAARASWKGH LKVGDLACAV GLYTAVSSSD RVSFNIINRR TGHRVERQFV DSETGKPVER        60
     GDQVKGYQME NGDYIVIEGD EIAEIMPESD KVLNIKAFIA YDDIDKLYFD RPYYLAPVDE       120
     HDEEALSLIA RGMRDGKVAA LAEAVLFRRN RTLLIRPHDD YIVATMLNFD YEVRSAETVF       180
     EDIPDIKFDK EMIALAGHII GTKQGSFEPS TYEDRYEAAL VELVKAKIEG RAPPKKKPAP       240
     ERKVVDLMEA LRQSAKMSGN APAKKALAKK KAPARSDSRS KKAS                        284
//

If you have problems or comments...

PBIL Back to PBIL home page