(data stored in ACNUC7421 zone)

EMBL: CP001622.PE308

CP001622.PE308       Location/Qualifiers
FT   CDS             complement(318230..318490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54620"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00619"
FT                   /protein_id="ACS54620.1"
FT                   /translation="MTDVRSMDNQGRRMDARDRLIVALYAQLKAERETRETLEWAIRNG
FT                   AVSQEVLEAIAADPVPVVTSEDIASLEKIIALDERRKANRN"
     MTDVRSMDNQ GRRMDARDRL IVALYAQLKA ERETRETLEW AIRNGAVSQE VLEAIAADPV        60
     PVVTSEDIAS LEKIIALDER RKANRN                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page