(data stored in ACNUC7421 zone)

EMBL: CP001622.PE309

CP001622.PE309       Location/Qualifiers
FT   CDS             318636..319196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0310"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG:
FT                   rec:RHECIAT_CH0000696 putative stress-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54621"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K2"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACS54621.1"
FT                   /translation="MADLKARPRPTGATAVLGRTGFPHVTSATKGEIDIVTAPSQPGFN
FT                   PLDLLYSSLSACLVLSARIAASQMGILDKINEITAEVTGEKATEGLSRVAKFNIAFSIK
FT                   GDIDEETRQKIAHAAEDEICTVSNTIRGNPEFSTTISGVRLNLHNNYRQSRAEDCVTNA
FT                   RLLCSGIESNDPGHHAAQASPDV"
     MADLKARPRP TGATAVLGRT GFPHVTSATK GEIDIVTAPS QPGFNPLDLL YSSLSACLVL        60
     SARIAASQMG ILDKINEITA EVTGEKATEG LSRVAKFNIA FSIKGDIDEE TRQKIAHAAE       120
     DEICTVSNTI RGNPEFSTTI SGVRLNLHNN YRQSRAEDCV TNARLLCSGI ESNDPGHHAA       180
     QASPDV                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page