(data stored in ACNUC7421 zone)

EMBL: CP001622.PE31

CP001622.PE31        Location/Qualifiers
FT   CDS             complement(30232..31029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0032"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000417 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase (phospholipid/glycerol acyltransferase)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54343"
FT                   /db_xref="GOA:C6AYB9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB9"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACS54343.1"
FT                   /translation="MIAWLRIAFAAVVILAVSIVLMPLQVLALRFDWRLRRRLPGTWHR
FT                   IVCYCLGIRVRVTGKLEDRRPLMLCSNHSSWLDIMVMSAVADVVFIAKIEVRDWPIFGT
FT                   LAKLQKSVFVVREERRKTGHQATEIAGRMADGEIVVLFPEGTTSDGNRLLEVKSSLFGA
FT                   AAMAVPTSPTGTVVVQPVAVAYTRVHGIAMGRYHRRLAAWPGDLDLLPHLIDIVRCGAI
FT                   DAEVSFGEAVDYRAETSRKEVSATIALRIRNLLNSRLRGREIS"
     MIAWLRIAFA AVVILAVSIV LMPLQVLALR FDWRLRRRLP GTWHRIVCYC LGIRVRVTGK        60
     LEDRRPLMLC SNHSSWLDIM VMSAVADVVF IAKIEVRDWP IFGTLAKLQK SVFVVREERR       120
     KTGHQATEIA GRMADGEIVV LFPEGTTSDG NRLLEVKSSL FGAAAMAVPT SPTGTVVVQP       180
     VAVAYTRVHG IAMGRYHRRL AAWPGDLDLL PHLIDIVRCG AIDAEVSFGE AVDYRAETSR       240
     KEVSATIALR IRNLLNSRLR GREIS                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page