(data stored in ACNUC7421 zone)

EMBL: CP001622.PE310

CP001622.PE310       Location/Qualifiers
FT   CDS             319168..320604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0311"
FT                   /product="putative FAD-dependent oxidoreductase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000697 putative FAD-dependent
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54622"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000697"
FT                   /protein_id="ACS54622.1"
FT                   /translation="MQPKPLPTSEQPVVAIIGGGVSGAGVAYHLARANCGERLAIVVFE
FT                   PRAELGRGLAYDTADPAHRINVPAAKMSLQPDDLGEFLAWIEVRDAVAGDPEARQPDGS
FT                   LFPRRRLFGDYVASLLKPLLEDGSVRHCRAAVTAVERCAGRWSIRDDRGGVTKADIVAI
FT                   ATSHPPPTAPSRLGSRLAAHPRFVADTTKPNALDVIRPHDRVLVIGNGLTAADVIASLA
FT                   QRGHDGSVTAISRRGLRSRGHPLVPQELFGDFVSSAAHSAVSLLRGIRTAIGAAKAQGI
FT                   SWHGVIDQVRAQGYDLWQALPVAERRRLVRHLRPYWDVHRFRIAPQVEAVLDAAVTSGR
FT                   LDILAGSVADARIEGELILCSLQPRHQRQPLERRYDAVVVTTGPAHGGILDTQPWLAAL
FT                   AANGHLALDPTGLGLACTERSEAIGPSGKVDPSLLISGPLARGTFGELMGLPQVTEHAF
FT                   FVAGEIAEKLRTSATNRHPA"
     MQPKPLPTSE QPVVAIIGGG VSGAGVAYHL ARANCGERLA IVVFEPRAEL GRGLAYDTAD        60
     PAHRINVPAA KMSLQPDDLG EFLAWIEVRD AVAGDPEARQ PDGSLFPRRR LFGDYVASLL       120
     KPLLEDGSVR HCRAAVTAVE RCAGRWSIRD DRGGVTKADI VAIATSHPPP TAPSRLGSRL       180
     AAHPRFVADT TKPNALDVIR PHDRVLVIGN GLTAADVIAS LAQRGHDGSV TAISRRGLRS       240
     RGHPLVPQEL FGDFVSSAAH SAVSLLRGIR TAIGAAKAQG ISWHGVIDQV RAQGYDLWQA       300
     LPVAERRRLV RHLRPYWDVH RFRIAPQVEA VLDAAVTSGR LDILAGSVAD ARIEGELILC       360
     SLQPRHQRQP LERRYDAVVV TTGPAHGGIL DTQPWLAALA ANGHLALDPT GLGLACTERS       420
     EAIGPSGKVD PSLLISGPLA RGTFGELMGL PQVTEHAFFV AGEIAEKLRT SATNRHPA         478
//

If you have problems or comments...

PBIL Back to PBIL home page