(data stored in ACNUC7421 zone)

EMBL: CP001622.PE311

CP001622.PE311       Location/Qualifiers
FT   CDS             320820..321725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0312"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rec:RHECIAT_CH0000698 putative
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54623"
FT                   /db_xref="GOA:C6B0K4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS54623.1"
FT                   /translation="MSQAAPTLSEASPSNRFALAALLLGGAAIGGSPIFVRLSEVGPMA
FT                   TAFWRVALALIPIVIVSLLKKERGPKPQSLSDYGMLILPGVILALDLAAWHLSLTMTSV
FT                   ANATLLANLAPVFVTLIAFVFFSARISRGFALGLVLALSGVVILKGGPAAIGNGDLRGD
FT                   GIAMIAAFFYACYILAIGRLRSRFDTLRIMLWSTTCAAACIFPIGLIYEGHMLPATVYG
FT                   WSIVFGLAFISHAGGQVAITYALAYLPPAFSSLTLLLQPVVAAILAWALLNEAIGTMQA
FT                   LGGAVVLAGIMIARTSRVQV"
     MSQAAPTLSE ASPSNRFALA ALLLGGAAIG GSPIFVRLSE VGPMATAFWR VALALIPIVI        60
     VSLLKKERGP KPQSLSDYGM LILPGVILAL DLAAWHLSLT MTSVANATLL ANLAPVFVTL       120
     IAFVFFSARI SRGFALGLVL ALSGVVILKG GPAAIGNGDL RGDGIAMIAA FFYACYILAI       180
     GRLRSRFDTL RIMLWSTTCA AACIFPIGLI YEGHMLPATV YGWSIVFGLA FISHAGGQVA       240
     ITYALAYLPP AFSSLTLLLQ PVVAAILAWA LLNEAIGTMQ ALGGAVVLAG IMIARTSRVQ       300
     V                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page