(data stored in ACNUC7421 zone)

EMBL: CP001622.PE312

CP001622.PE312       Location/Qualifiers
FT   CDS             complement(321738..323294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0313"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; phospholipase/Carboxylesterase; KEGG:
FT                   rec:RHECIAT_CH0000699 putative glyoxalase/bleomycin
FT                   resistance protein/dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54624"
FT                   /db_xref="GOA:C6B0K5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54624.1"
FT                   /translation="MVSGIHHVTAVTRKVQANVDFYAGFLGMRLVKQTAGYEDATQLHL
FT                   FYGDGEGTPGSLLTFLAWEDGAPGRAGYGQISEISLSINPTSIGYWLTRAMSFGLSSEG
FT                   PADEFGEPVLRLKDPDNIILKLAGAKSLVSPAAWDGASIPVEHAIQRVRGATMLTEKPT
FT                   ESRSFLESHFGYRFQASRGTIDRLVSQSGDIIDVRDARGFWSGAPGTGTVDHVAFRAAD
FT                   EETLLVVRKALEATDASPTNMHDRKYFRSLYAREPGGTLVELATDKPGMTVDEEQAALG
FT                   GKLFAPPEAITNLHDLKVMLPQFSMPGQPRVNYRELPFVHRFYTPPDPDGSVFVLLHGS
FT                   GGNETTLMPLLNKAAPRATLLGVRGRATEEGFPRWYKRITPFSFDQNDIKTEAEAFAAF
FT                   IEGAVKSYGLDPQKVVYVGYSNGANLLNSLLYLHPHLVHKAVLLRSMPVLSDYPHADLK
FT                   GTDLLVISGKTDAYGKYASELEGRLKSSGATVDSDVIPGGHDLGDADIPIIQKWLLQEN
FT                   R"
     MVSGIHHVTA VTRKVQANVD FYAGFLGMRL VKQTAGYEDA TQLHLFYGDG EGTPGSLLTF        60
     LAWEDGAPGR AGYGQISEIS LSINPTSIGY WLTRAMSFGL SSEGPADEFG EPVLRLKDPD       120
     NIILKLAGAK SLVSPAAWDG ASIPVEHAIQ RVRGATMLTE KPTESRSFLE SHFGYRFQAS       180
     RGTIDRLVSQ SGDIIDVRDA RGFWSGAPGT GTVDHVAFRA ADEETLLVVR KALEATDASP       240
     TNMHDRKYFR SLYAREPGGT LVELATDKPG MTVDEEQAAL GGKLFAPPEA ITNLHDLKVM       300
     LPQFSMPGQP RVNYRELPFV HRFYTPPDPD GSVFVLLHGS GGNETTLMPL LNKAAPRATL       360
     LGVRGRATEE GFPRWYKRIT PFSFDQNDIK TEAEAFAAFI EGAVKSYGLD PQKVVYVGYS       420
     NGANLLNSLL YLHPHLVHKA VLLRSMPVLS DYPHADLKGT DLLVISGKTD AYGKYASELE       480
     GRLKSSGATV DSDVIPGGHD LGDADIPIIQ KWLLQENR                               518
//

If you have problems or comments...

PBIL Back to PBIL home page