(data stored in ACNUC7421 zone)

EMBL: CP001622.PE313

CP001622.PE313       Location/Qualifiers
FT   CDS             complement(323379..324974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0314"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; KEGG: rec:RHECIAT_CH0000700 probable two-component
FT                   sensor histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54625"
FT                   /db_xref="GOA:C6B0K6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54625.1"
FT                   /translation="MAEHCSILIIDDNIDDLEVYRRILGRVSSTAYTVVEAETGEEGRA
FT                   LNGRKRPDCILLDYSLPGRDGLGVLADILEDDPAANVIMLTGQGSETVAVEVMKSGARD
FT                   YLTKDSLSPETLHRCIQNAIMHGMLEAKLEQKRQSLEIFTRAMAHDLKEPLRTIKSFTR
FT                   ILHGSAALPAEDRELLDYVLSAADHMEDLIVKVSGFTKLEASGGLELRPVSLSDVLDQV
FT                   EDNLRQQTESRGAVIIRGALPEVMGDATLLTQLLQNLVSNAIRYCEQKVPEISITGEAQ
FT                   GDTCRLTVRDNGPGIDPEHRELIFQPFKRLVGRGIEGTGLGLAICRRIAQMHGGSIWCE
FT                   AENGPGATFILEVPLAEARPVPSAASAVPHSTRPAEQQAEGSGRLAEVLLVEDSPADIQ
FT                   LLKIKLMRREKVNFNLHVATNGREAMRLLEERAGIADLPQIDLMLLDINMPIMDGFEVL
FT                   HALSADVRLKQIPVCILSTSSDESDMRRARNLGARAYMVKPPTLQQLEEALEDVENLEL
FT                   LQRGDSLALCAEQN"
     MAEHCSILII DDNIDDLEVY RRILGRVSST AYTVVEAETG EEGRALNGRK RPDCILLDYS        60
     LPGRDGLGVL ADILEDDPAA NVIMLTGQGS ETVAVEVMKS GARDYLTKDS LSPETLHRCI       120
     QNAIMHGMLE AKLEQKRQSL EIFTRAMAHD LKEPLRTIKS FTRILHGSAA LPAEDRELLD       180
     YVLSAADHME DLIVKVSGFT KLEASGGLEL RPVSLSDVLD QVEDNLRQQT ESRGAVIIRG       240
     ALPEVMGDAT LLTQLLQNLV SNAIRYCEQK VPEISITGEA QGDTCRLTVR DNGPGIDPEH       300
     RELIFQPFKR LVGRGIEGTG LGLAICRRIA QMHGGSIWCE AENGPGATFI LEVPLAEARP       360
     VPSAASAVPH STRPAEQQAE GSGRLAEVLL VEDSPADIQL LKIKLMRREK VNFNLHVATN       420
     GREAMRLLEE RAGIADLPQI DLMLLDINMP IMDGFEVLHA LSADVRLKQI PVCILSTSSD       480
     ESDMRRARNL GARAYMVKPP TLQQLEEALE DVENLELLQR GDSLALCAEQ N                531
//

If you have problems or comments...

PBIL Back to PBIL home page