(data stored in ACNUC7421 zone)

EMBL: CP001622.PE315

CP001622.PE315       Location/Qualifiers
FT   CDS             complement(325391..327532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0316"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rec:RHECIAT_CH0000702 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; PAS domain containing
FT                   protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54627"
FT                   /db_xref="GOA:C6B0K8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS54627.1"
FT                   /translation="MQDQGNVDLQDQPRQHYRAFAIAVGCLMLLLGATALTGWLLQAEI
FT                   VISLVPGFPSMAFNTALCFVLSGAGLAASTLAARRFRIMAAITMGLAAAIAAARLVEIV
FT                   TIGRSFHNVDVLISRFLVSPDFLAEIGGGMGPNTALVFLIANLSLLLSLQVEKSRSQVV
FT                   QELTSYVVITLGMIALASYVTDAEQGYRWGPYAAMALHTAAGMVIFGSGLLARSWWMQP
FT                   ANRAQIPLWIPAAVCFTGLLVDLYTPLGVANGILYVPLVLTALWFGNRNAPLFFAFACT
FT                   VLLMLGFFAVKHNEAAFWQEIANRAITAATLWLIAILVFYFMRNNYNLETERVRFGALV
FT                   RGTPDAVVVIDERGTIRNFNPAAESMFGYSPQETIGKNIKMLMPEPYHSEHDGYLAHYR
FT                   QTGDERIIGTTRMVSGRRKNGIVFPIDVSISAVVTGHTKTFVGIVRDISERVRQEERMK
FT                   TTLSQLEAYTAELERSNHDLDEFAYIASHDLKEPLRGLHNHSRFLLEDYEDKLDADGVR
FT                   RLNRLVRLSQRMEKLVNELLYFSRLGRQQLAVKRTDIGLIVKDVVATMELLLEERHAKV
FT                   IIDGRLPEVVCDATRLTEVFRNLITNAIKYNDKPAPLVSIGYLDRFVGKDGTVARNVFF
FT                   VKDNGKGIPREFHEDIFRIFKRLEKSQDSDDGTGAGLTFVRKIIARHNGDIWLESEVGT
FT                   GTTFYFTLGKKREGQNAAA"
     MQDQGNVDLQ DQPRQHYRAF AIAVGCLMLL LGATALTGWL LQAEIVISLV PGFPSMAFNT        60
     ALCFVLSGAG LAASTLAARR FRIMAAITMG LAAAIAAARL VEIVTIGRSF HNVDVLISRF       120
     LVSPDFLAEI GGGMGPNTAL VFLIANLSLL LSLQVEKSRS QVVQELTSYV VITLGMIALA       180
     SYVTDAEQGY RWGPYAAMAL HTAAGMVIFG SGLLARSWWM QPANRAQIPL WIPAAVCFTG       240
     LLVDLYTPLG VANGILYVPL VLTALWFGNR NAPLFFAFAC TVLLMLGFFA VKHNEAAFWQ       300
     EIANRAITAA TLWLIAILVF YFMRNNYNLE TERVRFGALV RGTPDAVVVI DERGTIRNFN       360
     PAAESMFGYS PQETIGKNIK MLMPEPYHSE HDGYLAHYRQ TGDERIIGTT RMVSGRRKNG       420
     IVFPIDVSIS AVVTGHTKTF VGIVRDISER VRQEERMKTT LSQLEAYTAE LERSNHDLDE       480
     FAYIASHDLK EPLRGLHNHS RFLLEDYEDK LDADGVRRLN RLVRLSQRME KLVNELLYFS       540
     RLGRQQLAVK RTDIGLIVKD VVATMELLLE ERHAKVIIDG RLPEVVCDAT RLTEVFRNLI       600
     TNAIKYNDKP APLVSIGYLD RFVGKDGTVA RNVFFVKDNG KGIPREFHED IFRIFKRLEK       660
     SQDSDDGTGA GLTFVRKIIA RHNGDIWLES EVGTGTTFYF TLGKKREGQN AAA              713
//

If you have problems or comments...

PBIL Back to PBIL home page