(data stored in ACNUC7421 zone)

EMBL: CP001622.PE316

CP001622.PE316       Location/Qualifiers
FT   CDS             327726..328103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0317"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000703 putative
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54628"
FT                   /db_xref="GOA:C6B0K9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54628.1"
FT                   /translation="MTTLFYVDDSKDDLFYLDYMSRKQQIDIDLFCFSTAETALEALET
FT                   RAAEGKTSPDLLVADLYMPLDSGIGLITRLRLDDRFKAMRLAICSGSDAAEDRARSLDA
FT                   GADVYLEKPLDLAKIILNLEM"
     MTTLFYVDDS KDDLFYLDYM SRKQQIDIDL FCFSTAETAL EALETRAAEG KTSPDLLVAD        60
     LYMPLDSGIG LITRLRLDDR FKAMRLAICS GSDAAEDRAR SLDAGADVYL EKPLDLAKII       120
     LNLEM                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page