(data stored in ACNUC7421 zone)

EMBL: CP001622.PE317

CP001622.PE317       Location/Qualifiers
FT   CDS             328584..329288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0318"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG:
FT                   ret:RHE_CH00628 LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54629"
FT                   /db_xref="GOA:C6B0L0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0L0"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54629.1"
FT                   /translation="MNNAPAIPFHAGPELSRAINRTDFFRLLKSAAQHYNFDNFALARI
FT                   SEASAPFGERDVVITNVAERRVGLFITTLKEALGTVRAKTAQFLATPVHGRSAQPEVYP
FT                   SDLVFNEFLSGVFLFIPLFTPEGRRYCLVLSGERQEPDQSEIADILLDAMRIFDKLYEE
FT                   ILTPEMSGRLTQRESEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVH
FT                   MVAIALRNGLVS"
     MNNAPAIPFH AGPELSRAIN RTDFFRLLKS AAQHYNFDNF ALARISEASA PFGERDVVIT        60
     NVAERRVGLF ITTLKEALGT VRAKTAQFLA TPVHGRSAQP EVYPSDLVFN EFLSGVFLFI       120
     PLFTPEGRRY CLVLSGERQE PDQSEIADIL LDAMRIFDKL YEEILTPEMS GRLTQRESEI       180
     VKWTSEGKTS AEIAIILGLS EHTVNSHITA AARKLDAVNR VHMVAIALRN GLVS             234
//

If you have problems or comments...

PBIL Back to PBIL home page