(data stored in ACNUC7421 zone)

EMBL: CP001622.PE318

CP001622.PE318       Location/Qualifiers
FT   CDS             329319..329756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0319"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000705 putative two-component
FT                   response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54630"
FT                   /db_xref="GOA:C6B1B1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000705"
FT                   /protein_id="ACS54630.1"
FT                   /translation="MITETGRRNAVKVLFVDDEFIEFRALKKKIADLSEPAVEVEYSPS
FT                   IGDALEKIRLARFDLILLDNRLLPNADFRETVPELRGIGYTGPIGVVSTDISGGYFQEF
FT                   PDYGVDFRIGKDEIDAQTLQHIIREYVTYDVPDFWKDDYSI"
     MITETGRRNA VKVLFVDDEF IEFRALKKKI ADLSEPAVEV EYSPSIGDAL EKIRLARFDL        60
     ILLDNRLLPN ADFRETVPEL RGIGYTGPIG VVSTDISGGY FQEFPDYGVD FRIGKDEIDA       120
     QTLQHIIREY VTYDVPDFWK DDYSI                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page