(data stored in ACNUC7421 zone)

EMBL: CP001622.PE319

CP001622.PE319       Location/Qualifiers
FT   CDS             complement(329760..330476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0320"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: ret:RHE_CH00630 putative two-component
FT                   sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54631"
FT                   /db_xref="GOA:C6B1B2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54631.1"
FT                   /translation="MSSNPTRPPETTVAGDSEERIKRFLATASHDLQSPLRHIAMYAEL
FT                   LLDDLEETLDGEQLQSLRMIMEKAQTAQRLTKALMSLAAGTPQVTPEEVDLQALAENVW
FT                   GELTDETAVGAATLESDGLPSIRTDPALLGLVLRHLLTNALTYRGEAPPHVAIAAERER
FT                   TDWFIRISDNGTGIDPAYRERIFEPFWKLPKAGAVPGAGLGLTTAREFLAALGGDISLE
FT                   RSDESGSRFIIRLPIA"
     MSSNPTRPPE TTVAGDSEER IKRFLATASH DLQSPLRHIA MYAELLLDDL EETLDGEQLQ        60
     SLRMIMEKAQ TAQRLTKALM SLAAGTPQVT PEEVDLQALA ENVWGELTDE TAVGAATLES       120
     DGLPSIRTDP ALLGLVLRHL LTNALTYRGE APPHVAIAAE RERTDWFIRI SDNGTGIDPA       180
     YRERIFEPFW KLPKAGAVPG AGLGLTTARE FLAALGGDIS LERSDESGSR FIIRLPIA         238
//

If you have problems or comments...

PBIL Back to PBIL home page