(data stored in ACNUC7421 zone)

EMBL: CP001622.PE32

CP001622.PE32        Location/Qualifiers
FT   CDS             complement(31057..31485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0033"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG:
FT                   rec:RHECIAT_CH0000418 ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54344"
FT                   /db_xref="GOA:C6AYC0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC0"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACS54344.1"
FT                   /translation="MTDVAKTLEELCTERGMRMTEQRRVIARILEDSEDHPDVEELYRR
FT                   SVKVDAKISISTVYRTVKLFEDAGIIARHDFRDGRSRYETVPEEHHDHLIDLKTGTVIE
FT                   FRSPEIEALQERIAREHGFRLVDHRLELYGVPLKKEDL"
     MTDVAKTLEE LCTERGMRMT EQRRVIARIL EDSEDHPDVE ELYRRSVKVD AKISISTVYR        60
     TVKLFEDAGI IARHDFRDGR SRYETVPEEH HDHLIDLKTG TVIEFRSPEI EALQERIARE       120
     HGFRLVDHRL ELYGVPLKKE DL                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page