(data stored in ACNUC7421 zone)

EMBL: CP001622.PE320

CP001622.PE320       Location/Qualifiers
FT   CDS             complement(330635..333181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0321"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein SecF; protein-export
FT                   membrane protein, SecD/SecF family; PFAM: SecD/SecF/SecDF
FT                   export membrane protein; KEGG: rec:RHECIAT_CH0000707
FT                   protein-export translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54632"
FT                   /db_xref="GOA:C6B1B3"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B3"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ACS54632.1"
FT                   /translation="MRTSRWLVITYSVIILLGLLIALPNVLPQSVLQRVPAWLPHEQVS
FT                   LGLDLRGGSHLVLEVDEADLTKERLQSLLQDARRVLREKGIQPKAVVRSQNQIVVTLAD
FT                   AAQSDAAVTELKTLANPISTGLSAGQADLAVTANGATITVGFSPAGISANVDNAVQQSL
FT                   EVIRQRVDQVGVSEPTIQRIGANRVLVQLPGAQDPSRLRELLGSTAKMSFHMLSPNNAP
FT                   GPGVTMLKDDEGRSFPVLDRVEISGDRLSDARVSFDPNTHEPIVSFRFDSAGASRFAEI
FT                   TRQNVGNPFAIVLDDKVLSAPVIREPITGGSGQISGSFSADSATTLAAMLRAGALPAKL
FT                   TVIEERTVGADLGADAIKMGIYSGIVGFVLVAVFIFVLYGTWGFLANIALLIHTILTFS
FT                   ALTLVGATLTLPGIAGVVLGIGLAVDANVLINERIREETRKGKSAFAAIDTGFRRAYST
FT                   IIDGNMTALIAAAILFFFGSGPVRGFAVTMALGLIISMFTSVAFVRVAMIEITRRSKLK
FT                   VLNIRPLIPFSPYDKHIQFMKARFFGITVSALLSIASIVLFIHPGLNYGVDFRGGIQMA
FT                   VKTTGPADLGTFREGLNTLGLGEISLQSFGDKNSILVRAQRQEGGEEAQTAAVTKLKAE
FT                   VTKIDPTATIEGTDVIGPKVSGELAWAGILSVVIASFAMLIYIWVRFEWPFAVGAIVTL
FT                   VLDVTKAIGFFAITGLDFNLTAIAAILTLVGYSVNDKVVVYDRMRENMRLYKSMPLREI
FT                   IDKSINETLARSLYTNATAFLALVPMAIWGGSAVSSFAIPMVFGILVAGASSIFIAAPI
FT                   LLFLGDWRRRHAKASATDAAVEIIPPEQGRPRKSAS"
     MRTSRWLVIT YSVIILLGLL IALPNVLPQS VLQRVPAWLP HEQVSLGLDL RGGSHLVLEV        60
     DEADLTKERL QSLLQDARRV LREKGIQPKA VVRSQNQIVV TLADAAQSDA AVTELKTLAN       120
     PISTGLSAGQ ADLAVTANGA TITVGFSPAG ISANVDNAVQ QSLEVIRQRV DQVGVSEPTI       180
     QRIGANRVLV QLPGAQDPSR LRELLGSTAK MSFHMLSPNN APGPGVTMLK DDEGRSFPVL       240
     DRVEISGDRL SDARVSFDPN THEPIVSFRF DSAGASRFAE ITRQNVGNPF AIVLDDKVLS       300
     APVIREPITG GSGQISGSFS ADSATTLAAM LRAGALPAKL TVIEERTVGA DLGADAIKMG       360
     IYSGIVGFVL VAVFIFVLYG TWGFLANIAL LIHTILTFSA LTLVGATLTL PGIAGVVLGI       420
     GLAVDANVLI NERIREETRK GKSAFAAIDT GFRRAYSTII DGNMTALIAA AILFFFGSGP       480
     VRGFAVTMAL GLIISMFTSV AFVRVAMIEI TRRSKLKVLN IRPLIPFSPY DKHIQFMKAR       540
     FFGITVSALL SIASIVLFIH PGLNYGVDFR GGIQMAVKTT GPADLGTFRE GLNTLGLGEI       600
     SLQSFGDKNS ILVRAQRQEG GEEAQTAAVT KLKAEVTKID PTATIEGTDV IGPKVSGELA       660
     WAGILSVVIA SFAMLIYIWV RFEWPFAVGA IVTLVLDVTK AIGFFAITGL DFNLTAIAAI       720
     LTLVGYSVND KVVVYDRMRE NMRLYKSMPL REIIDKSINE TLARSLYTNA TAFLALVPMA       780
     IWGGSAVSSF AIPMVFGILV AGASSIFIAA PILLFLGDWR RRHAKASATD AAVEIIPPEQ       840
     GRPRKSAS                                                                848
//

If you have problems or comments...

PBIL Back to PBIL home page