(data stored in ACNUC7421 zone)

EMBL: CP001622.PE321

CP001622.PE321       Location/Qualifiers
FT   CDS             complement(333265..333645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54633"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000708"
FT                   /protein_id="ACS54633.1"
FT                   /translation="MELEQHRLTSRIAASVLVAVLAYLGLLFGGNLVISPAAAANTLSS
FT                   SGRDPQPPQLTARDTVRGLLATERKLVPKQTAHDGGSPALAAAPTLNFAGWNISAAFPA
FT                   FEASLHAAVSRTHQPRAPPVAA"
     MELEQHRLTS RIAASVLVAV LAYLGLLFGG NLVISPAAAA NTLSSSGRDP QPPQLTARDT        60
     VRGLLATERK LVPKQTAHDG GSPALAAAPT LNFAGWNISA AFPAFEASLH AAVSRTHQPR       120
     APPVAA                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page