(data stored in ACNUC7421 zone)

EMBL: CP001622.PE322

CP001622.PE322       Location/Qualifiers
FT   CDS             complement(333700..335520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0323"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; KEGG: ret:RHE_CH00633 putative potassium-efflux
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54634"
FT                   /db_xref="GOA:C6B1B5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B5"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACS54634.1"
FT                   /translation="MPHDTPLISTIVGGLVLAFIFGAFAHRLRMPPLVGYLIAGVLVGP
FT                   HTPGYVADQNLAPELAEIGVILLMFGVGLHFSLKDLLSVRGIAVPGAIVQIAFATLLGW
FT                   GLGAFMGWPTGGSLVFGLALSVASTVVLLKALQERRLVETERGRIAVGWLIVEDLAMVL
FT                   ALVLIPAAASIGGEGHAPVEPLSAALSRLFGLDLGIGGMIAMTLVKVALFVALMLVFGR
FT                   KLIPWTMHRIAHTGSRELFRLGVLAIALGVAFGAAKLFGVSLALGAFFAGMVLAESELS
FT                   HRAAQESLPLRDAFAVLFFVSVGMLFDPNILIDKPLPILATIFIIVIGKSVAALLIVLA
FT                   FKKPLSTALTISASLGQIGEFSFILAALGVELGLLPEEGRDLILAGAIISIILNPLLFF
FT                   LCDRMRPLLDGAKREDVAADPAPAADAIAAPEEIPPEDDEVHPTALRGHAILVGYGRVG
FT                   SIVGQNLKSSATPFLVIEDSDKRIGELKAQGIETLAGNAVMRETLDLANLSGARSIAIA
FT                   IPNAFEACRIAEQARSVNPSILIVARAHSDAEVDELKQYGADTVIMGEREIALGMVDRL
FT                   AQVHHESVPYEDSHGPDTIAPTDDPPPERE"
     MPHDTPLIST IVGGLVLAFI FGAFAHRLRM PPLVGYLIAG VLVGPHTPGY VADQNLAPEL        60
     AEIGVILLMF GVGLHFSLKD LLSVRGIAVP GAIVQIAFAT LLGWGLGAFM GWPTGGSLVF       120
     GLALSVASTV VLLKALQERR LVETERGRIA VGWLIVEDLA MVLALVLIPA AASIGGEGHA       180
     PVEPLSAALS RLFGLDLGIG GMIAMTLVKV ALFVALMLVF GRKLIPWTMH RIAHTGSREL       240
     FRLGVLAIAL GVAFGAAKLF GVSLALGAFF AGMVLAESEL SHRAAQESLP LRDAFAVLFF       300
     VSVGMLFDPN ILIDKPLPIL ATIFIIVIGK SVAALLIVLA FKKPLSTALT ISASLGQIGE       360
     FSFILAALGV ELGLLPEEGR DLILAGAIIS IILNPLLFFL CDRMRPLLDG AKREDVAADP       420
     APAADAIAAP EEIPPEDDEV HPTALRGHAI LVGYGRVGSI VGQNLKSSAT PFLVIEDSDK       480
     RIGELKAQGI ETLAGNAVMR ETLDLANLSG ARSIAIAIPN AFEACRIAEQ ARSVNPSILI       540
     VARAHSDAEV DELKQYGADT VIMGEREIAL GMVDRLAQVH HESVPYEDSH GPDTIAPTDD       600
     PPPERE                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page