(data stored in ACNUC7421 zone)

EMBL: CP001622.PE323

CP001622.PE323       Location/Qualifiers
FT   CDS             335555..335854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54635"
FT                   /db_xref="GOA:C6B1B6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B6"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00634"
FT                   /protein_id="ACS54635.1"
FT                   /translation="MTYMVYIDQYGQLEIMGQGARETILTPALCRAARGLLDWTQTDLA
FT                   DRAAVSRSTIRDYEGRHHDIHRATEAQLRLAFEEGGVKFVEIQGAGTGVYLPTA"
     MTYMVYIDQY GQLEIMGQGA RETILTPALC RAARGLLDWT QTDLADRAAV SRSTIRDYEG        60
     RHHDIHRATE AQLRLAFEEG GVKFVEIQGA GTGVYLPTA                               99
//

If you have problems or comments...

PBIL Back to PBIL home page