(data stored in ACNUC7421 zone)

EMBL: CP001622.PE324

CP001622.PE324       Location/Qualifiers
FT   CDS             complement(335936..337357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0325"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="KEGG: ret:RHE_CH00635 putative glycosyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54636"
FT                   /db_xref="GOA:C6B1B7"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B7"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00635"
FT                   /protein_id="ACS54636.1"
FT                   /translation="MSPRSGLLIVLGFTLWRVVMLNFDTTDLFVDEAQYWFWSQNLDLG
FT                   YYSKPPMIAWVIRAMTELSGSNAIYWIRLLGPLIHMAAALVLMKTAKRFVGPEIEGWTG
FT                   ATYITLPGVALSSVFFSTDVILLFFIAIALLAYFGLTQRRSVGLALVMGLGVGLAFLTK
FT                   YAVLFVVPGGALALLLIPAARIAIRDFIIAVAVAAVVALPNLWWNLQHDNTTVRHTQDI
FT                   AHWSELGINLRRGLEFFAAQFGVVGPIIFFAMLWAVYRMIKGRSDDREKMLVWLSMPVV
FT                   VLITLQATVAKAYANWAVTAYVAGTILAVWLLYLKWPKGLRLSLTINGIASLLFPLATI
FT                   FPHQLLLPNGDALMKRYLGRAEVSRETAALAAQAGTDIIVTDNRDMVADLFYTLRDASY
FT                   RIYARAPAGLPESYYEQEFALPADITGKVLFLTDGAFTCATETPEVLKNWQPTEGNYKG
FT                   KTLSIYKVSAACLAP"
     MSPRSGLLIV LGFTLWRVVM LNFDTTDLFV DEAQYWFWSQ NLDLGYYSKP PMIAWVIRAM        60
     TELSGSNAIY WIRLLGPLIH MAAALVLMKT AKRFVGPEIE GWTGATYITL PGVALSSVFF       120
     STDVILLFFI AIALLAYFGL TQRRSVGLAL VMGLGVGLAF LTKYAVLFVV PGGALALLLI       180
     PAARIAIRDF IIAVAVAAVV ALPNLWWNLQ HDNTTVRHTQ DIAHWSELGI NLRRGLEFFA       240
     AQFGVVGPII FFAMLWAVYR MIKGRSDDRE KMLVWLSMPV VVLITLQATV AKAYANWAVT       300
     AYVAGTILAV WLLYLKWPKG LRLSLTINGI ASLLFPLATI FPHQLLLPNG DALMKRYLGR       360
     AEVSRETAAL AAQAGTDIIV TDNRDMVADL FYTLRDASYR IYARAPAGLP ESYYEQEFAL       420
     PADITGKVLF LTDGAFTCAT ETPEVLKNWQ PTEGNYKGKT LSIYKVSAAC LAP              473
//

If you have problems or comments...

PBIL Back to PBIL home page