(data stored in ACNUC7421 zone)

EMBL: CP001622.PE326

CP001622.PE326       Location/Qualifiers
FT   CDS             338186..339820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0327"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000713
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54638"
FT                   /db_xref="GOA:C6B1B9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54638.1"
FT                   /translation="MPSDQARGAQAGSLRDRLRFAGLDTDQCELVRRNRPALEAHLKAG
FT                   LRDLFHRFQSFPDASRNFESERQVERLHDLQSSHWDVLTDARFDSLYAERVKVLSDTES
FT                   KMGLDPRWHVAGHGVMLEHVVSGLAEQIAGRPLLPSAKRRTREISDLMTAIIRIVMVDV
FT                   EIAVSLRFNALRAGEQRALADQRAANEAEIIRIFGDVIEGLSARDLTRRAPVDGDGAYG
FT                   GIAAALNGALDGLQAEFTAITERTVKAEAATGSLAGLSRQFAGTASGQADRLQLSAAAL
FT                   AGIAGSVRDGAADSRAAEQAAATTRAAVEESGEVVGRAISAMADIEQSAEKIGQIIGAI
FT                   DEIAFQTNLLALNAGIEAARAGDSGRGFAVVAQEVRALAQRSAEAAREIKTLVTTTKAQ
FT                   VDAGVQMVGRTQDSIGSIVRQVTDINAAISGIATRTGEHAASLDSVTSDVKGLGGEVAD
FT                   SAGLAERSAEGADHLHSVILELGQTIREFRIARENATAGRPAPVRVTPPRALEGATRPA
FT                   PVVDEYENDDFGLPQAFASVGGGRNVY"
     MPSDQARGAQ AGSLRDRLRF AGLDTDQCEL VRRNRPALEA HLKAGLRDLF HRFQSFPDAS        60
     RNFESERQVE RLHDLQSSHW DVLTDARFDS LYAERVKVLS DTESKMGLDP RWHVAGHGVM       120
     LEHVVSGLAE QIAGRPLLPS AKRRTREISD LMTAIIRIVM VDVEIAVSLR FNALRAGEQR       180
     ALADQRAANE AEIIRIFGDV IEGLSARDLT RRAPVDGDGA YGGIAAALNG ALDGLQAEFT       240
     AITERTVKAE AATGSLAGLS RQFAGTASGQ ADRLQLSAAA LAGIAGSVRD GAADSRAAEQ       300
     AAATTRAAVE ESGEVVGRAI SAMADIEQSA EKIGQIIGAI DEIAFQTNLL ALNAGIEAAR       360
     AGDSGRGFAV VAQEVRALAQ RSAEAAREIK TLVTTTKAQV DAGVQMVGRT QDSIGSIVRQ       420
     VTDINAAISG IATRTGEHAA SLDSVTSDVK GLGGEVADSA GLAERSAEGA DHLHSVILEL       480
     GQTIREFRIA RENATAGRPA PVRVTPPRAL EGATRPAPVV DEYENDDFGL PQAFASVGGG       540
     RNVY                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page