(data stored in ACNUC7421 zone)

EMBL: CP001622.PE327

CP001622.PE327       Location/Qualifiers
FT   CDS             339884..340180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0328"
FT                   /product="chemotaxis protein CheX"
FT                   /note="KEGG: rec:RHECIAT_CH0000714 chemotaxis protein CheX"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54639"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000714"
FT                   /protein_id="ACS54639.1"
FT                   /translation="MAAKKSGKTLDLTAVLDLNEASALRDKLLSLRGSGLSIDASGVER
FT                   IGALCAQVLMSAEKTWEQDKQPFTFSKVSDAFQKTMQLVGVNIDHLLAKEIRQ"
     MAAKKSGKTL DLTAVLDLNE ASALRDKLLS LRGSGLSIDA SGVERIGALC AQVLMSAEKT        60
     WEQDKQPFTF SKVSDAFQKT MQLVGVNIDH LLAKEIRQ                                98
//

If you have problems or comments...

PBIL Back to PBIL home page