(data stored in ACNUC7421 zone)

EMBL: CP001622.PE328

CP001622.PE328       Location/Qualifiers
FT   CDS             340177..340542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0329"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000715 chemotaxis
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54640"
FT                   /db_xref="GOA:C6B1C1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54640.1"
FT                   /translation="MKKKVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLEES
FT                   NPDVIVTDINMPRLDGFGFIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIV
FT                   KPFDPAKLIDAIERVTA"
     MKKKVLTVDD SRTIRNMLLV TLNNAGFETI QAEDGIEGLE VLEESNPDVI VTDINMPRLD        60
     GFGFIEGVRR NEKYRAIPIL VLTTESDAEK KNRARQAGAT GWIVKPFDPA KLIDAIERVT       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page