(data stored in ACNUC7421 zone)

EMBL: CP001622.PE329

CP001622.PE329       Location/Qualifiers
FT   CDS             340560..342836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0330"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000716 chemotaxis two-component
FT                   sensor histidine kinase protein; PFAM: ATP-binding region
FT                   ATPase domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; CheW domain protein;
FT                   SMART: CheW domain protein; Hpt domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54641"
FT                   /db_xref="GOA:C6B1C2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C2"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACS54641.1"
FT                   /translation="MDMNEIKEIFFQECEEQLAELESGLLKMNDGDRDPETVNAVFRAV
FT                   HSIKGGAGAFGLDDLVAFAHVFETTLDCVRSNKLEPNQDVLKVMLKSADVLADLTNVAR
FT                   DGGSVDESRSRGLVRELEALANGEMPSPSASVEAPAPKAAAKAAPAPTPKPTDDSGFQP
FT                   VPFSFDDFGGEGDAGGMPAYEVIFKPRYELYSKGNDATLLLRDLSRLGEMTIYCNTDDL
FT                   PGLEELDPEGAYFFWNVTIKTDKGEDAIRTVFEFAEWDCELTVKPVEEARAEATSNDEL
FT                   PMVPVPFDLSILDEAGAIEEVSASDARAEETAAAVAAAETASNVTQIVAARVEKKESAA
FT                   AAAAAASAAAQNNAAGAGQTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTTGTSS
FT                   INMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSIRLITEGENTE
FT                   VDKTVIDKLAEPLTHMIRNAVDHGIETPEKRAAAGKNTEGTVRLTAKHRSGRILIELAD
FT                   DGAGINREKVRQKAIDNDLIPADSNLSDEEIDNLIFLPGFSTADKISDISGRGVGMDVV
FT                   KRSIQALGGRINITSKPGHGSVFTMSLPLTLAVLDGMVVTVAGQTLVVPLTAIVETLQP
FT                   EAAAIHSFGANHRLISIRNSFCPLVDVGRILNFRATQANPVEGVALLVESEGGGQRALM
FT                   VDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAVVGASRGQSLKAEMS
FT                   LAAVG"
     MDMNEIKEIF FQECEEQLAE LESGLLKMND GDRDPETVNA VFRAVHSIKG GAGAFGLDDL        60
     VAFAHVFETT LDCVRSNKLE PNQDVLKVML KSADVLADLT NVARDGGSVD ESRSRGLVRE       120
     LEALANGEMP SPSASVEAPA PKAAAKAAPA PTPKPTDDSG FQPVPFSFDD FGGEGDAGGM       180
     PAYEVIFKPR YELYSKGNDA TLLLRDLSRL GEMTIYCNTD DLPGLEELDP EGAYFFWNVT       240
     IKTDKGEDAI RTVFEFAEWD CELTVKPVEE ARAEATSNDE LPMVPVPFDL SILDEAGAIE       300
     EVSASDARAE ETAAAVAAAE TASNVTQIVA ARVEKKESAA AAAAAASAAA QNNAAGAGQT       360
     IRVDLDRVDR LINLVGELVI NQAMLSQSVI ENDTTGTSSI NMGLEELQQL TREIQDSVMA       420
     IRAQPVKPVF QRMSRIVREI ADMTGKSIRL ITEGENTEVD KTVIDKLAEP LTHMIRNAVD       480
     HGIETPEKRA AAGKNTEGTV RLTAKHRSGR ILIELADDGA GINREKVRQK AIDNDLIPAD       540
     SNLSDEEIDN LIFLPGFSTA DKISDISGRG VGMDVVKRSI QALGGRINIT SKPGHGSVFT       600
     MSLPLTLAVL DGMVVTVAGQ TLVVPLTAIV ETLQPEAAAI HSFGANHRLI SIRNSFCPLV       660
     DVGRILNFRA TQANPVEGVA LLVESEGGGQ RALMVDAIQG QRQVVIKSLE ANYTHVPGIA       720
     AATILGDGRV ALILDVDAVV GASRGQSLKA EMSLAAVG                               758
//

If you have problems or comments...

PBIL Back to PBIL home page