(data stored in ACNUC7421 zone)

EMBL: CP001622.PE330

CP001622.PE330       Location/Qualifiers
FT   CDS             342841..343308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0331"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: rec:RHECIAT_CH0000717 chemotaxis signal
FT                   transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54642"
FT                   /db_xref="GOA:C6B1C3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C3"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACS54642.1"
FT                   /translation="MSYTVKNLNEGDRELIAFRIGDQEFCVNIMSVREIRGWTPATAMP
FT                   HSPGYMLGVINLRGAVLPIIDLAARLGMKPADPTARHVIIVAQVRRKVVGLLVDAVSDI
FT                   LTVTDETIQPTPEISSELERQFARGILAIEKRMICLIELESLFPETESEAA"
     MSYTVKNLNE GDRELIAFRI GDQEFCVNIM SVREIRGWTP ATAMPHSPGY MLGVINLRGA        60
     VLPIIDLAAR LGMKPADPTA RHVIIVAQVR RKVVGLLVDA VSDILTVTDE TIQPTPEISS       120
     ELERQFARGI LAIEKRMICL IELESLFPET ESEAA                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page