(data stored in ACNUC7421 zone)

EMBL: CP001622.PE331

CP001622.PE331       Location/Qualifiers
FT   CDS             343305..344213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0332"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: rec:RHECIAT_CH0000718 methyl-accepting
FT                   chemotaxis protein O-methyltransferase protein; PFAM: MCP
FT                   methyltransferase CheR-type; SMART: MCP methyltransferase
FT                   CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54643"
FT                   /db_xref="GOA:C6B1C4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C4"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ACS54643.1"
FT                   /translation="MSVMGAKDQRQGSDEVLASGEYPLTRRDLTEIAAMIYSDAGIFLN
FT                   ETKASLVYSRLSKHIRNLGLSGFREYCDLVASPAGAAPRREMLSHLTTNFTRFFRENHH
FT                   FDHLRDHVLPELLQRARSGGRVRIWSAASSDGQEPYSIALTVLSLMPNVADYDFKILAT
FT                   DIDPKILAIARAGAYDESALETVSPAMRKQWFSEVEIQGRRKFQVDDRVKRLITYNELN
FT                   LMAQWPFKGKFDVIFCRNVVIYFDEPTQMKIWQRFAGLLPEGGHLYIGHSERVSGEAKH
FT                   VFDNIGITTYRYTSKGLGRKA"
     MSVMGAKDQR QGSDEVLASG EYPLTRRDLT EIAAMIYSDA GIFLNETKAS LVYSRLSKHI        60
     RNLGLSGFRE YCDLVASPAG AAPRREMLSH LTTNFTRFFR ENHHFDHLRD HVLPELLQRA       120
     RSGGRVRIWS AASSDGQEPY SIALTVLSLM PNVADYDFKI LATDIDPKIL AIARAGAYDE       180
     SALETVSPAM RKQWFSEVEI QGRRKFQVDD RVKRLITYNE LNLMAQWPFK GKFDVIFCRN       240
     VVIYFDEPTQ MKIWQRFAGL LPEGGHLYIG HSERVSGEAK HVFDNIGITT YRYTSKGLGR       300
     KA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page