(data stored in ACNUC7421 zone)

EMBL: CP001622.PE332

CP001622.PE332       Location/Qualifiers
FT   CDS             344210..345253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0333"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="KEGG: rec:RHECIAT_CH0000719 chemotaxis-specific
FT                   methylesterase protein; PFAM: CheB methylesterase; response
FT                   regulator receiver; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54644"
FT                   /db_xref="GOA:C6B1C5"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C5"
FT                   /inference="protein motif:PRIAM:3.1.1.61"
FT                   /protein_id="ACS54644.1"
FT                   /translation="MSAPARVLVVDDSPTMRGLITAVLSSDPEVNVIGQAGDALEAREA
FT                   IKRLNPDVLTLDIEMPNMNGLDFLEKIMTLRPMPVIMVSTMTHRGAEATLAALEIGAFD
FT                   CVGKPAPGELRPFGDLAEKVKAAARTQRQYSQPVAAVAPPPSVGDFRVGRKIVAIGSST
FT                   GGVEALIAVLQKFPANCPPTVITQHMPPTFTKSFAERLNRLCAPVVQEATDGARLEIGK
FT                   IYLAPGGERHLQVSNASAPCCRLIDRAPVNGHRPSVDVLFDSVAELAGRNAVGVILTGM
FT                   GRDGAAGLLKMRHAGARTLGQNEKTCVVYGMPRVAHELGAVEQQLPLSAIGEEILKMTA
FT                   ARKEGTE"
     MSAPARVLVV DDSPTMRGLI TAVLSSDPEV NVIGQAGDAL EAREAIKRLN PDVLTLDIEM        60
     PNMNGLDFLE KIMTLRPMPV IMVSTMTHRG AEATLAALEI GAFDCVGKPA PGELRPFGDL       120
     AEKVKAAART QRQYSQPVAA VAPPPSVGDF RVGRKIVAIG SSTGGVEALI AVLQKFPANC       180
     PPTVITQHMP PTFTKSFAER LNRLCAPVVQ EATDGARLEI GKIYLAPGGE RHLQVSNASA       240
     PCCRLIDRAP VNGHRPSVDV LFDSVAELAG RNAVGVILTG MGRDGAAGLL KMRHAGARTL       300
     GQNEKTCVVY GMPRVAHELG AVEQQLPLSA IGEEILKMTA ARKEGTE                     347
//

If you have problems or comments...

PBIL Back to PBIL home page