(data stored in ACNUC7421 zone)

EMBL: CP001622.PE334

CP001622.PE334       Location/Qualifiers
FT   CDS             345640..346194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0335"
FT                   /product="CheD, stimulates methylation of MCP protein"
FT                   /note="PFAM: CheD family protein; KEGG:
FT                   rec:RHECIAT_CH0000721 chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54646"
FT                   /db_xref="GOA:C6B1C7"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C7"
FT                   /inference="protein motif:PFAM:PF03975"
FT                   /protein_id="ACS54646.1"
FT                   /translation="MITEGAARRVHIIQGEYKVLNDPNAVLSTILGSCVAACLRDPVAG
FT                   VGGMNHFLLPGSATSPTSGGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAKTIS
FT                   TFSNVGEQNAAFAVQFLRDEGIPVVGSSTGGEHGRKLEYWPVSGRARQYPLTGAETQRT
FT                   VALEQRPAAPQKPVETSIEFF"
     MITEGAARRV HIIQGEYKVL NDPNAVLSTI LGSCVAACLR DPVAGVGGMN HFLLPGSATS        60
     PTSGGDATRY GVHLMELLIN GLLKQGARRD RLEAKIFGGA KTISTFSNVG EQNAAFAVQF       120
     LRDEGIPVVG SSTGGEHGRK LEYWPVSGRA RQYPLTGAET QRTVALEQRP AAPQKPVETS       180
     IEFF                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page