(data stored in ACNUC7421 zone)

EMBL: CP001622.PE335

CP001622.PE335       Location/Qualifiers
FT   CDS             346211..346600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54647"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C8"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00645"
FT                   /protein_id="ACS54647.1"
FT                   /translation="MTFTQMMETPAPVEALSDILMRIVSELHDVAYLIERIEPQLLDLG
FT                   SAEILNSPDAMKVMQGIDLAVQKSRGLAEFIDTITGEIPHGWAVDVATALSLVKLAEMQ
FT                   KALGGATRHGHSQPLSKAAGDFDFF"
     MTFTQMMETP APVEALSDIL MRIVSELHDV AYLIERIEPQ LLDLGSAEIL NSPDAMKVMQ        60
     GIDLAVQKSR GLAEFIDTIT GEIPHGWAVD VATALSLVKL AEMQKALGGA TRHGHSQPLS       120
     KAAGDFDFF                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page