(data stored in ACNUC7421 zone)

EMBL: CP001622.PE336

CP001622.PE336       Location/Qualifiers
FT   CDS             346810..348501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0337"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring domain protein; KEGG: rec:RHECIAT_CH0000723
FT                   flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54648"
FT                   /db_xref="GOA:C6B1C9"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C9"
FT                   /inference="protein motif:TFAM:TIGR00206"
FT                   /protein_id="ACS54648.1"
FT                   /translation="MNLLNQLVQIFKNFGSLGRTRLMILGGVGAVSIAIVLAAALFVNK
FT                   PAQETLYVGLDSPDLNQISMALAEANINFQVGTDGTSISVPAGMTGKARLMLAERGLPN
FT                   SANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNF
FT                   RKAEQKPTASVMIRASATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEA
FT                   SNSSLNRSLNIVQNVQQEVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPE
FT                   SKVERSVRSTKEAQQSQQKQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNY
FT                   EINSKTTATTRSSYKVEKLSIAVVVNKGRIAKMVGEPADQTKVDAYLAEMQKIVASAAG
FT                   IDAKRGDVVTVTAMDFLENQLLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFLVVWMG
FT                   LRPLVRSVSGNGSSAAFGDATPEAAGLELPDFAPASGAPGGALMDGFGSDFGFDSTEDL
FT                   LSLGDDDGNFNRRVKEGPERKLSRMVEINEERAAKILRKWAIDEAA"
     MNLLNQLVQI FKNFGSLGRT RLMILGGVGA VSIAIVLAAA LFVNKPAQET LYVGLDSPDL        60
     NQISMALAEA NINFQVGTDG TSISVPAGMT GKARLMLAER GLPNSANAGY ELFDNVGSLG       120
     LTSFMQEVTR VRALEGEIAR TIQSISGITA ARVHIVMPEV GNFRKAEQKP TASVMIRASA       180
     TTGRSAATSI RHLVASAVPG LDVDDVTILD SAGQLLASGD EASNSSLNRS LNIVQNVQQE       240
     VESNIDKALA PFLGMDNFRS SVTADLNTDA QQIQETTYDP ESKVERSVRS TKEAQQSQQK       300
     QSDSATTVEQ NIPQAAPEAG GSAGPESQDK SDKREEQTNY EINSKTTATT RSSYKVEKLS       360
     IAVVVNKGRI AKMVGEPADQ TKVDAYLAEM QKIVASAAGI DAKRGDVVTV TAMDFLENQL       420
     LEDATGGVRV MDMLSRNLAG IINSLAFVAV AFLVVWMGLR PLVRSVSGNG SSAAFGDATP       480
     EAAGLELPDF APASGAPGGA LMDGFGSDFG FDSTEDLLSL GDDDGNFNRR VKEGPERKLS       540
     RMVEINEERA AKILRKWAID EAA                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page