(data stored in ACNUC7421 zone)

EMBL: CP001622.PE337

CP001622.PE337       Location/Qualifiers
FT   CDS             348947..349693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0338"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Bacterio-opsin
FT                   activator HTH domain protein; SMART: regulatory protein
FT                   LuxR; KEGG: rec:RHECIAT_CH0000724 probable transcriptional
FT                   regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54649"
FT                   /db_xref="GOA:C6B1D0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D0"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54649.1"
FT                   /translation="MDMNVIQASKGERQMANFASAAVPDLLPRDELLQRLHGVASTGRL
FT                   QSGLRALTDYVGASYYLLARCDLLQESGLDFIVSSDWPFDLVRDIANDLVRGYARSTEL
FT                   EKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNVGRSRLALMFLFGEGFILSPERLRD
FT                   VGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWIAEGKTSDEIAMILGISRNTINNY
FT                   ITSVMRKTATKTRSEAIAFAVRNNLV"
     MDMNVIQASK GERQMANFAS AAVPDLLPRD ELLQRLHGVA STGRLQSGLR ALTDYVGASY        60
     YLLARCDLLQ ESGLDFIVSS DWPFDLVRDI ANDLVRGYAR STELEKCMQV FQPNFALLPD       120
     SAEVPDGASR QYCSVTFNVG RSRLALMFLF GEGFILSPER LRDVGLLAGY VASFLRCGGT       180
     KVDRDFELTD RELECLFWIA EGKTSDEIAM ILGISRNTIN NYITSVMRKT ATKTRSEAIA       240
     FAVRNNLV                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page