(data stored in ACNUC7421 zone)

EMBL: CP001622.PE338

CP001622.PE338       Location/Qualifiers
FT   CDS             349702..350448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0339"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: rec:RHECIAT_CH0000725 probable
FT                   transcriptional regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54650"
FT                   /db_xref="GOA:C6B1D1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54650.1"
FT                   /translation="MGYPSGRTMSSAEQLRMVRVNRISSRSDLFPRLIAMQKLADAQGF
FT                   AIFRVSGSGIPAKQRLVCELENWGSSNAGFGKAFTDAYGDILLDHIDKSLLPLSWAGGY
FT                   DRAAPGPADFSPFMTRLQDGILPFSGLAFPVRLGAVGNGFILFTGDEIDPSSDTIVELH
FT                   GRCCHIMMDLLSLDERRTAAAEALSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYL
FT                   GSATIKLDSVNRIQAIAKAIRLGYIS"
     MGYPSGRTMS SAEQLRMVRV NRISSRSDLF PRLIAMQKLA DAQGFAIFRV SGSGIPAKQR        60
     LVCELENWGS SNAGFGKAFT DAYGDILLDH IDKSLLPLSW AGGYDRAAPG PADFSPFMTR       120
     LQDGILPFSG LAFPVRLGAV GNGFILFTGD EIDPSSDTIV ELHGRCCHIM MDLLSLDERR       180
     TAAAEALSER EIACLQLAGD GRISEEIADK LGLSVHTVNA YLGSATIKLD SVNRIQAIAK       240
     AIRLGYIS                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page