(data stored in ACNUC7421 zone)

EMBL: CP001622.PE339

CP001622.PE339       Location/Qualifiers
FT   CDS             complement(350561..351004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54651"
FT                   /db_xref="InterPro:IPR017024"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000726"
FT                   /protein_id="ACS54651.1"
FT                   /translation="MKKCPHSTQREKILADAISPVATELRLLDASDLISLLRFEYYGNL
FT                   SDLVASAAELFFHPGTVNFGLGGNYTLEWGGKPEVVLDLEIKPRGVTVYAQLTLAEDHA
FT                   GIEINHIAFQNPSADPDENTIFLRRSLRESRYSINQPPQTLAG"
     MKKCPHSTQR EKILADAISP VATELRLLDA SDLISLLRFE YYGNLSDLVA SAAELFFHPG        60
     TVNFGLGGNY TLEWGGKPEV VLDLEIKPRG VTVYAQLTLA EDHAGIEINH IAFQNPSADP       120
     DENTIFLRRS LRESRYSINQ PPQTLAG                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page