(data stored in ACNUC7421 zone)

EMBL: CP001622.PE34

CP001622.PE34        Location/Qualifiers
FT   CDS             complement(32065..32727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0035"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   ret:RHE_CH00380 O-sialoglycoprotein endopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54346"
FT                   /db_xref="GOA:C6AYC2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC2"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ACS54346.1"
FT                   /translation="MIILALDTAGVDCAAAVFDSGRNTVLGEASDMIGKGHAEHLIGIV
FT                   DRALDQAGLALSDVDRLAVTIGPGSFTGIRVGVAAARGFALSLNVPAVGITTLEVMASA
FT                   QRDKTPHRAVLAAMDAKRDEIYLQSFAADGSPLDAPRAVSVAQAQAFAAGFDGEITGSA
FT                   TPLLKADAGGDHTNRFPISIVARLGAAASPDSGKPKPLYLRGPDAKPQAGYAIARRV"
     MIILALDTAG VDCAAAVFDS GRNTVLGEAS DMIGKGHAEH LIGIVDRALD QAGLALSDVD        60
     RLAVTIGPGS FTGIRVGVAA ARGFALSLNV PAVGITTLEV MASAQRDKTP HRAVLAAMDA       120
     KRDEIYLQSF AADGSPLDAP RAVSVAQAQA FAAGFDGEIT GSATPLLKAD AGGDHTNRFP       180
     ISIVARLGAA ASPDSGKPKP LYLRGPDAKP QAGYAIARRV                             220
//

If you have problems or comments...

PBIL Back to PBIL home page