(data stored in ACNUC7421 zone)

EMBL: CP001622.PE340

CP001622.PE340       Location/Qualifiers
FT   CDS             complement(351010..352089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0341"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: rec:RHECIAT_CH0000727
FT                   flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54652"
FT                   /db_xref="GOA:C6B1D3"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D3"
FT                   /inference="protein motif:TFAM:TIGR00328"
FT                   /protein_id="ACS54652.1"
FT                   /translation="MADDDKDSKTEAPTAKKQSDAAEKGNVPSSRELSIFATILATFIY
FT                   LVFFLPDSVGRMSETLRDIFEQPDQWKIETGPDVLALFVRLGWASAALVAPAFILFMVF
FT                   GVASSVFQNLPTLVLERIRPQASRISPIKGWSRLFSVPGLVEFGKSLFKVVVVGVILFF
FT                   VLRSEYFGSIDAMFSDPQTILVRLMAAMRKIIIVMLIATAIVAIADLFWTRHHWFTELK
FT                   MTRHEVKEENKQAQGDPFVKSRQRSLMRDRARRRMIADVHRATLVIANPTHYAVALRYA
FT                   REENDAPVVLAKGQDLIALKIREIAEKNGIPVFEDPPLARSMFAQVSIDSVIPSVFYKA
FT                   VAELIHRVYAADAKNKRVR"
     MADDDKDSKT EAPTAKKQSD AAEKGNVPSS RELSIFATIL ATFIYLVFFL PDSVGRMSET        60
     LRDIFEQPDQ WKIETGPDVL ALFVRLGWAS AALVAPAFIL FMVFGVASSV FQNLPTLVLE       120
     RIRPQASRIS PIKGWSRLFS VPGLVEFGKS LFKVVVVGVI LFFVLRSEYF GSIDAMFSDP       180
     QTILVRLMAA MRKIIIVMLI ATAIVAIADL FWTRHHWFTE LKMTRHEVKE ENKQAQGDPF       240
     VKSRQRSLMR DRARRRMIAD VHRATLVIAN PTHYAVALRY AREENDAPVV LAKGQDLIAL       300
     KIREIAEKNG IPVFEDPPLA RSMFAQVSID SVIPSVFYKA VAELIHRVYA ADAKNKRVR        359
//

If you have problems or comments...

PBIL Back to PBIL home page