(data stored in ACNUC7421 zone)

EMBL: CP001622.PE341

CP001622.PE341       Location/Qualifiers
FT   CDS             complement(352426..353466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0342"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="PFAM: flagellar motor switch protein FliG; KEGG:
FT                   rec:RHECIAT_CH0000728 flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54653"
FT                   /db_xref="GOA:C6B1D4"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D4"
FT                   /inference="protein motif:PFAM:PF01706"
FT                   /protein_id="ACS54653.1"
FT                   /translation="MMDFDDFGGALAGKPLTQAEKAAAVLLAMGKGVAGRLLKYFTQAE
FT                   LQTIISSAQSLRAIPPDELLLLVSEFEDLFTEGAGLMDNAKAIEAILEEGLTPDEVDSL
FT                   LGRRTAFQAYETSIWDRLSEAEPTFVAQFLLREHPQTVAYILSMMPSSFGAKVLLQLPD
FT                   NRRADIMNRTVNMKTVSPKAAQIIENQVMTLLAEVEAERNAAGSTKVADLMNELDKPQV
FT                   DTLLSSLESISRESVNKVRPKIFLFEDLMYMPQRSRVMLLNDISTDVLTVALRGSPPEI
FT                   RESVLSAISPRQRRMIESDLQSGMGGVNPREIAIARRAVAQEAIRLANSGQIELKEKEG
FT                   DASAAA"
     MMDFDDFGGA LAGKPLTQAE KAAAVLLAMG KGVAGRLLKY FTQAELQTII SSAQSLRAIP        60
     PDELLLLVSE FEDLFTEGAG LMDNAKAIEA ILEEGLTPDE VDSLLGRRTA FQAYETSIWD       120
     RLSEAEPTFV AQFLLREHPQ TVAYILSMMP SSFGAKVLLQ LPDNRRADIM NRTVNMKTVS       180
     PKAAQIIENQ VMTLLAEVEA ERNAAGSTKV ADLMNELDKP QVDTLLSSLE SISRESVNKV       240
     RPKIFLFEDL MYMPQRSRVM LLNDISTDVL TVALRGSPPE IRESVLSAIS PRQRRMIESD       300
     LQSGMGGVNP REIAIARRAV AQEAIRLANS GQIELKEKEG DASAAA                      346
//

If you have problems or comments...

PBIL Back to PBIL home page