(data stored in ACNUC7421 zone)

EMBL: CP001622.PE342

CP001622.PE342       Location/Qualifiers
FT   CDS             complement(353495..354079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0343"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   rec:RHECIAT_CH0000729 flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54654"
FT                   /db_xref="GOA:C6B1D5"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D5"
FT                   /inference="protein motif:TFAM:TIGR02480"
FT                   /protein_id="ACS54654.1"
FT                   /translation="MATKKTQQNSDLSLDLPGSEADLDQAIDDLRGVLKQDADGDLPQF
FT                   GDDPQSDPFAAGTDLAAFGGEASESPFGGDDFGGDFGGSASSAAGMDFGSSPSFEESPA
FT                   PLGSALNSNFDLIMDIPIDVQIMLGTSRMQVSGLMNLNEGATIALDKKIGEPVEIMVNG
FT                   RRIARGEITVLDNDDTRFGVKLIEVLSTKKA"
     MATKKTQQNS DLSLDLPGSE ADLDQAIDDL RGVLKQDADG DLPQFGDDPQ SDPFAAGTDL        60
     AAFGGEASES PFGGDDFGGD FGGSASSAAG MDFGSSPSFE ESPAPLGSAL NSNFDLIMDI       120
     PIDVQIMLGT SRMQVSGLMN LNEGATIALD KKIGEPVEIM VNGRRIARGE ITVLDNDDTR       180
     FGVKLIEVLS TKKA                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page